#hollywood

WORLD NEWS BREAKING NEWS HOLLYWOOD CELEBRITIES EXPOSED - THEY ALL LIED TO US! YOU MAY NEVER TRUST ANOTHER CELEBRITY AFTER WATCHING THIS SHORT FILM

WHERE THEY GO ONE THEY GO ALL!!! TO TRIBUNAL

supported by
@TRIBUNALSforJUSTICE
and
@GitmoTV

https://t.me/ExposeThePEDOSendTheCABAL/3974

What’s In These Jabs & What Can They Do? (The Evidence Will Flabbergast You) (Video)
https://bestnewshere.com/whats-in-these-jabs-what-can-they-do-the-evidence-will-flabbergast-you-video/

Best Explanation I've Seen About Why the Covid Jabs Are Killer Shots
https://rumble.com/vlvhy5-best-explanation-ive-seen-about-why-the-covid-jabs-are-killer-shots.html

Bombshell: Government Special Ops Demo Expert Confesses To Planting Explosives In WTCs Before 9/11
https://bestnewshere.com/bombshell-government-special-ops-demo-expert-confesses-to-planting-explosives-in-wtcs-before-9-11/

https://realrawnews.com/2021/09/military-convicts-bill-gates/

Please subscribe to channel
https://t.me/irelandtogether

#WorldNews #BreakingNews #America #Hollywood #Celebrities

2 days, 10 hours ago

just wondering
imagine frat bro hollywood the awesome space kingdom movies and fntasy kingdom movies?
sicifi novels and comics and video games great again
China 1race kingdom mass produces cities and puts minorities in re-education camps and breeds them away and white kingdoms should too!!
holy shit!! white super empire global pyramid network pre history? What was lost in the library of alexandira ? the finno korean hyperwar might be a small blip compares to the ancient white space empires!!
king now gak minorities in whtie kingodoms starting with jews! free houses for whites and mass produce cities all engineer no middleman no bankers businessman mpa mph shrnks academics lawyers teachers or other useless tits ALL engineers and king print money and give to engineer to build 800 rooms per subject of king!
burn big tek and burn all media for treason
use free software and geopolymer and flibe.com safe atomic power with liquid salt thorium reactor! https://www.bitchute.com/video/euGBTzhn5npb/
picolisp.com
greenarrays.com
https://9p.io/plan9/about.html
happstack.com
archlinux.org with iceWM desktop and pcmanFM gui file manager like windows explorer
openbsd.org
https://www.cs.kent.ac.uk/projects/ofa/kroc/rmox-cpa.pdf
https://colorforth.github.io/
http://www.croquet.zone/ alan kay and xerox parc invented all of modern computing with good government with 12mil a year aand 25 researchers and computing is not at that level yet now
capitalism is usury and didn't build anything US is white ethnostate 99.99% white until 1940 and 1932 law said to empigrate had to be whtie MALE in good moral standing look it up
jews are anti white racists who make up fake history and steal what majority race built through usury and funny money printing look at big tek now no ad cash its all made up and tek is shit compared to free software and what was done in 1960s 70s see alan kay https://youtu.be/WTNgtvDVXCE

3 days, 2 hours ago

China 1race kingdom mass produces cities and puts minorities in re-education camps and breeds them away and white kingdoms should too!!
holy shit!! white super empire global pyramid network pre history? What was lost in the library of alexandira ? the finno korean hyperwar might be a small blip compares to the ancient white space empires!!
king now gak minorities in whtie kingodoms starting with jews! free houses for whites and mass produce cities all engineer no middleman no bankers businessman mpa mph shrnks academics lawyers teachers or other useless tits ALL engineers and king print money and give to engineer to build 800 rooms per subject of king!
burn big tek and burn all media for treason
use free software and geopolymer and flibe.com safe atomic power with liquid salt thorium reactor! https://www.bitchute.com/video/euGBTzhn5npb/
picolisp.com
greenarrays.com
https://9p.io/plan9/about.html
happstack.com
archlinux.org with iceWM desktop and pcmanFM gui file manager like windows explorer
openbsd.org
https://www.cs.kent.ac.uk/projects/ofa/kroc/rmox-cpa.pdf
https://colorforth.github.io/
http://www.croquet.zone/ alan kay and xerox parc invented all of modern computing with good government with 12mil a year aand 25 researchers and computing is not at that level yet now
capitalism is usury and didn't build anything US is white ethnostate 99.99% white until 1940 and 1932 law said to empigrate had to be whtie MALE in good moral standing look it up
jews are anti white racists who make up fake history and steal what majority race built through usury and funny money printing look at big tek now no ad cash its all made up and tek is shit compared to free software and what was done in 1960s 70s see alan kay https://youtu.be/WTNgtvDVXCE

3 days, 2 hours ago

just wondering
imagine frat bro hollywood the awesome space kingdom movies and fntasy kingdom movies?
sicifi novels and comics and video games great again
China 1race kingdom mass produces cities and puts minorities in re-education camps and breeds them away and white kingdoms should too!!
holy shit!! white super empire global pyramid network pre history? What was lost in the library of alexandira ? the finno korean hyperwar might be a small blip compares to the ancient white space empires!!
king now gak minorities in whtie kingodoms starting with jews! free houses for whites and mass produce cities all engineer no middleman no bankers businessman mpa mph shrnks academics lawyers teachers or other useless tits ALL engineers and king print money and give to engineer to build 800 rooms per subject of king!
burn big tek and burn all media for treason
use free software and geopolymer and flibe.com safe atomic power with liquid salt thorium reactor! https://www.bitchute.com/video/euGBTzhn5npb/
picolisp.com
greenarrays.com
https://9p.io/plan9/about.html
happstack.com
archlinux.org with iceWM desktop and pcmanFM gui file manager like windows explorer
openbsd.org
https://www.cs.kent.ac.uk/projects/ofa/kroc/rmox-cpa.pdf
https://colorforth.github.io/
http://www.croquet.zone/ alan kay and xerox parc invented all of modern computing with good government with 12mil a year aand 25 researchers and computing is not at that level yet now
capitalism is usury and didn't build anything US is white ethnostate 99.99% white until 1940 and 1932 law said to empigrate had to be whtie MALE in good moral standing look it up
jews are anti white racists who make up fake history and steal what majority race built through usury and funny money printing look at big tek now no ad cash its all made up and tek is shit compared to free software and what was done in 1960s 70s see alan kay https://youtu.be/WTNgtvDVXCE

3 days, 2 hours ago

China 1race kingdom mass produces cities and puts minorities in re-education camps and breeds them away and white kingdoms should too!!
holy shit!! white super empire global pyramid network pre history? What was lost in the library of alexandira ? the finno korean hyperwar might be a small blip compares to the ancient white space empires!!
king now gak minorities in whtie kingodoms starting with jews! free houses for whites and mass produce cities all engineer no middleman no bankers businessman mpa mph shrnks academics lawyers teachers or other useless tits ALL engineers and king print money and give to engineer to build 800 rooms per subject of king!
burn big tek and burn all media for treason
use free software and geopolymer and flibe.com safe atomic power with liquid salt thorium reactor! https://www.bitchute.com/video/euGBTzhn5npb/
picolisp.com
greenarrays.com
https://9p.io/plan9/about.html
happstack.com
archlinux.org with iceWM desktop and pcmanFM gui file manager like windows explorer
openbsd.org
https://www.cs.kent.ac.uk/projects/ofa/kroc/rmox-cpa.pdf
https://colorforth.github.io/
http://www.croquet.zone/ alan kay and xerox parc invented all of modern computing with good government with 12mil a year aand 25 researchers and computing is not at that level yet now
capitalism is usury and didn't build anything US is white ethnostate 99.99% white until 1940 and 1932 law said to empigrate had to be whtie MALE in good moral standing look it up
jews are anti white racists who make up fake history and steal what majority race built through usury and funny money printing look at big tek now no ad cash its all made up and tek is shit compared to free software and what was done in 1960s 70s see alan kay https://youtu.be/WTNgtvDVXCE

3 days, 3 hours ago

China 1race kingdom mass produces cities and puts minorities in re-education camps and breeds them away and white kingdoms should too!!
holy shit!! white super empire global pyramid network pre history? What was lost in the library of alexandira ? the finno korean hyperwar might be a small blip compares to the ancient white space empires!!
king now gak minorities in whtie kingodoms starting with jews! free houses for whites and mass produce cities all engineer no middleman no bankers businessman mpa mph shrnks academics lawyers teachers or other useless tits ALL engineers and king print money and give to engineer to build 800 rooms per subject of king!
burn big tek and burn all media for treason
use free software and geopolymer and flibe.com safe atomic power with liquid salt thorium reactor! https://www.bitchute.com/video/euGBTzhn5npb/
picolisp.com
greenarrays.com
https://9p.io/plan9/about.html
happstack.com
archlinux.org with iceWM desktop and pcmanFM gui file manager like windows explorer
openbsd.org
https://www.cs.kent.ac.uk/projects/ofa/kroc/rmox-cpa.pdf
https://colorforth.github.io/
http://www.croquet.zone/ alan kay and xerox parc invented all of modern computing with good government with 12mil a year aand 25 researchers and computing is not at that level yet now
capitalism is usury and didn't build anything US is white ethnostate 99.99% white until 1940 and 1932 law said to empigrate had to be whtie MALE in good moral standing look it up
jews are anti white racists who make up fake history and steal what majority race built through usury and funny money printing look at big tek now no ad cash its all made up and tek is shit compared to free software and what was done in 1960s 70s see alan kay https://youtu.be/WTNgtvDVXCE

3 days, 3 hours ago

China 1race kingdom mass produces cities and puts minorities in re-education camps and breeds them away and white kingdoms should too!!
holy shit!! white super empire global pyramid network pre history? What was lost in the library of alexandira ? the finno korean hyperwar might be a small blip compares to the ancient white space empires!!
king now gak minorities in whtie kingodoms starting with jews! free houses for whites and mass produce cities all engineer no middleman no bankers businessman mpa mph shrnks academics lawyers teachers or other useless tits ALL engineers and king print money and give to engineer to build 800 rooms per subject of king!
burn big tek and burn all media for treason
use free software and geopolymer and flibe.com safe atomic power with liquid salt thorium reactor! https://www.bitchute.com/video/euGBTzhn5npb/
picolisp.com
greenarrays.com
https://9p.io/plan9/about.html
happstack.com
archlinux.org with iceWM desktop and pcmanFM gui file manager like windows explorer
openbsd.org
https://www.cs.kent.ac.uk/projects/ofa/kroc/rmox-cpa.pdf
https://colorforth.github.io/
http://www.croquet.zone/ alan kay and xerox parc invented all of modern computing with good government with 12mil a year aand 25 researchers and computing is not at that level yet now
capitalism is usury and didn't build anything US is white ethnostate 99.99% white until 1940 and 1932 law said to empigrate had to be whtie MALE in good moral standing look it up
jews are anti white racists who make up fake history and steal what majority race built through usury and funny money printing look at big tek now no ad cash its all made up and tek is shit compared to free software and what was done in 1960s 70s see alan kay https://youtu.be/WTNgtvDVXCE

3 days, 3 hours ago

China 1race kingdom mass produces cities and puts minorities in re-education camps and breeds them away and white kingdoms should too!!
holy shit!! white super empire global pyramid network pre history? What was lost in the library of alexandira ? the finno korean hyperwar might be a small blip compares to the ancient white space empires!!
king now gak minorities in whtie kingodoms starting with jews! free houses for whites and mass produce cities all engineer no middleman no bankers businessman mpa mph shrnks academics lawyers teachers or other useless tits ALL engineers and king print money and give to engineer to build 800 rooms per subject of king!
burn big tek and burn all media for treason
use free software and geopolymer and flibe.com safe atomic power with liquid salt thorium reactor! https://www.bitchute.com/video/euGBTzhn5npb/
picolisp.com
greenarrays.com
https://9p.io/plan9/about.html
happstack.com
archlinux.org with iceWM desktop and pcmanFM gui file manager like windows explorer
openbsd.org
https://www.cs.kent.ac.uk/projects/ofa/kroc/rmox-cpa.pdf
https://colorforth.github.io/
http://www.croquet.zone/ alan kay and xerox parc invented all of modern computing with good government with 12mil a year aand 25 researchers and computing is not at that level yet now
capitalism is usury and didn't build anything US is white ethnostate 99.99% white until 1940 and 1932 law said to empigrate had to be whtie MALE in good moral standing look it up
jews are anti white racists who make up fake history and steal what majority race built through usury and funny money printing look at big tek now no ad cash its all made up and tek is shit compared to free software and what was done in 1960s 70s see alan kay https://youtu.be/WTNgtvDVXCE

3 days, 3 hours ago

MET GALA GAMES 2021

SUBSCRIBE AND HELP PROTECT MY WORK:

YOUTUBE : http://www.youtube.com/c/Q2CASTTV

BITCHUTE: https://www.bitchute.com/channel/B9cDhgaUYCES/

ODYSEE: https://odysee.com/@Q2CAST:7

YOU CAN HELP PROTECT THIS NETWORK BY DONATING
PAYPAL:
https://www.paypal.com/paypalme/Q2CASTTV?locale.x=en_US

STREAMLABS:
https://streamlabs.com/nxsudios/v2

MERCHANDISE STORE: SHOPQ2CAST.COM

YOU CAN FIND US ON THESE SOCIAL MEDIA PLATFORMS:

FACEBOOK:
https://www.facebook.com/Q2castnetwork
https://www.facebook.com/madmanwithashow

TWITTER:
https://twitter.com/Q2cast1

3 days, 13 hours ago

DONATE : https://paypal.me/radiobaloney

Help support the channel, it’s greatly appreciated!

BITCOIN: 39RcYsrHy7JrRju2tjkECmCxasfGv3L5bC

ETHEREUM: 0x9fba2c0162bd0f1580f37bc0cada97a012cfdc25

Rose Mcgowan says she's no longer a democrat and is supporting Larry Elder in the California recall election.

#rosemcgowan #larryelder #california

https://www.foxnews.com/politics/rose-mcgowan-calls-out-blm-during-event-with-larry-elder

Website : www.radiobaloney.com

Youtube : https://youtube.com/c/RADIOBALONEY

Bitchute : https://www.bitchute.com/channel/radio_baloney/

Odysee :https://odysee.com/@RADIO_BALONEY

Rumble. :https://rumble.com/register/Radio_Baloney/

Minds. : https://www.minds.com/radio_baloney/?referrer=radio_baloney?referrer=radio_baloney

Spreaker podcast : https://www.spreaker.com/show/the-richie-baloney-show

4 days, 5 hours ago
4 days, 12 hours ago

CBS decided to virtue signal by pandering to the social justice activist Left with a new game show where contestants work with a celebrity to push leftist agendas. The winners of the competition then get to pitch their activism to the globalists at the G20 summit in an attempt to secure funding for it. Basically, they’ve created what amounts to a Cultural Marxist Shark Tank. This did not go over well with the leftists to put it nicely. But, that could be because they just expect to have everything handed to them without having to work for it.

In this video we take a look at CBS’s retarded attempt to pander to these people even after Shari Redstone has regained control of the network because the social justice/Cultural Marxist agenda was killing it.

Where you can find me:

BitChute: https://www.bitchute.com/channel/constitutionalist-libertarian/

Odysee: https://odysee.com/@ConstitutionalistLibertarian

D.Tube: https://d.tube/c-libertarian

Rumble: https://rumble.com/c/c-365367

Minds: https://www.minds.com/ConstitutionalistLibertarian

Gab: https://gab.com/ConstitutionalLibertarian

Parler: https://parler.com/profile/ConstitutionalistLibertarian/

Facebook: https://www.facebook.com/constitutionalist.libertarian.18

YouTube: Banned

Twitter: Banned

5 days, 23 hours ago
6 days, 13 hours ago

Guest Kelly Galindo discusses her documentary film on global sex trafficking "26 Seconds", Hollywood, and healing from trauma.

Award winning film maker and champion in the fight to end child and human trafficking Kelly Galindo joins us to discuss her game changing documentary project 26 Seconds. 26 Seconds is a dramatic feature documentary focusing on the horrors of sex trafficking around the world. Through a captivating journey in search of solutions, Galindo reveals the ubiquity of the problem and the gravity of the damage sustained by this evil, destructive trade. In raw, intimate interviews filmed in Thailand, Cambodia, Iraq, India, East Africa, Mexico, and right here in the USA, the audience gets a shocking glimpse into the lives of girls, women, pimps, and “Johns” from various cultures and regions. The documentary peers behind the shadowy curtain of the rampant global plague of sex trafficking, taking audiences from the neon underground in Thailand to the dusty refugee camps of Iraq; from the glitz and glam of Las Vegas to Tijuana; from the sunny streets of Southern California to the slums of New Delhi and Phnom Penh and the rift valleys of East Africa.

Directed by Kelly Galindo
Edited by Scott Arundale
Cinematography by Nico Aguilar & Brodin Plett
Music by Tiffany

KellyGalindoProductions LLC ©

****************************************
Please support Kelly's Youtube Channel:
https://www.youtube.com/c/26Seconds

26 Seconds Website:
http://www.26secondsdoc.com/

GIVE SURVIVORS A VOICE
By donating you will help to complete the feature documentary to highlight survivor stories and the Non-profit organizations that are in the fight to eradicate global sex-trafficking.
​CREATE AWARENESS
Together we can raise awareness of the non-profit organizations, crisis intervention teams, committed law enforcement and dedicated citizens fighting to eradicate global sex trafficking.
​​CALL TO ACTION
Share the 26 Seconds documentary short and YouTube videos on social media. Your support is the difference and the impact needed to defend and protect innocent children and women all around the world.

https://26seconds.wedid.it/campaigns/...

#humantrafficking #hollywood #scientology

******************************
👽 E-mail: [email protected]
👌 Instagram: https://www.instagram.com/dougscottkramer/
🚭 Facebook: https://www.facebook.com/dougscottkramer
✌ Patreon: https://www.patreon.com/DazedButNotConfuzed?fan_landing=true

1 week ago
BNN

Sep 9, 2021

War Room With Owen Shroyer

Why is Dr. Fauci so hell bent on mad scientist style research and pharmaceutical corruption?

Check out the latest deals and hottest products at the Infowars Store!
https://www.infowarsstore.com/

1 week, 2 days ago
1 week, 3 days ago

LGBTQRTSYKDDFGHDFVGASDGFHASWFHAEWRWHFVDFSDFB+ Agenda

1 week, 3 days ago

What they are showing us in movies is closer to reality than many even have a clue. Source: Pirate Pete. More videos you might find informational:
WEAPONIZED VACCINE WITH MUTANT SPIKE PROTEIN CAUSES VIRUS TO EXPLODE INTO RAGING INFECTION
https://www.bitchute.com/video/s9oxNW3QeUQv/

Vaccines From Hell - Banned On YouTube!
https://www.bitchute.com/video/5iSV1eibKiZx/

The Story Of Ivermectin And COVID-19
https://www.bitchute.com/video/E3y7jzAgHGvn/

False Flag: Vaccination centers to be attacked. In other words...(translation below)
https://www.bitchute.com/video/iPBP3ZzQaw10/

Crisis in America: Millions of Nurses are Resigning or Being Fired Over COVID Vaccine Mandates
https://www.bitchute.com/video/HSbpp0ZhkJCR/

Walmart’s are being turned into Military Bases/Prisons.
https://www.bitchute.com/video/0PfmTK87oGqI/

The Ultimate False Flag Event. The fake Alien Invasion. A Greg Reese Report
https://www.bitchute.com/video/uYZSMazRFXI5/

CLONES & ALIENS - It is a crazy world.
https://www.bitchute.com/video/6niX0bWYuUBe/

1 million or more dead. Their screams are being silenced by the media. It is murder. It is GENOCIDE.
https://www.bitchute.com/video/qEMI2AAiiHGO/

NYC DROWNS IN ITS OWN SH*T AFTER SEWAGE BLOWBACK. HOLY CRAP!
https://www.bitchute.com/video/vlJTO9nU3kpR/

Doctor takes safe and effective vaccination, passes out during surgery. He did his homework...not.
https://www.bitchute.com/video/DVnxXTK8cCkf/

ACTOR MURDERED BY MODERNA - Ed Asners advice - "Do it get it over with"...He did.
https://www.bitchute.com/video/XEznFKoA7tc1/

WALMARTS ARE MILITARY BASES (with thousands of miles of underground tunnels linking them)
https://www.bitchute.com/video/RG7krOjwH0a4/

Alarming: Experimental Covid Vaccines now proving to be extremely toxic to humans
https://www.bitchute.com/video/00IqaFaw4t8C/

BOMBSHELL: Hundreds of ADE deaths are quietly being entered into VAERS
https://www.bitchute.com/video/OPzjEasm0zXB/

Man gets injected with Pfizer shot, now his body can charge his phone. How handy can you get?
https://www.bitchute.com/video/T70XOkRoWGR3/

Why are Walmart's around the country looking like this? Why would you need these at a Walmart?
https://www.bitchute.com/video/TpCcoiJT42yt/

BLOCKBUSTER - Info from the "Dark Webb" Who owns shares of Pfizer and is profiting from the VAX?
https://www.bitchute.com/video/jEJeicuxPj1V/

1 week, 4 days ago

Rose admitted to the world that she was once “with” Hillary’s Husband Bill Clinton in a hotel room. The entire tweet was just scathing top to bottom – ripping Hillary limb from limb. McGowan then tells Hillary about the hotel room and Bill Clinton and then ends the tweet with a very bizarre and cryptic line.
. I’ve been Rose was commenting on an article about Hillary’s statement about the new abortion laws and she directed her comment right at Hillary, by tagging her in the tweet.
Here’s what Rose said: “@HillaryClinton, You are a shadow leader in service of evil. You are the enemy of what is good, right and moral. You represent no flag, no country, no soul. You eat hope, you twist mindsin a hotel room with your husband and here comes the bomb.”

1 week, 4 days ago
1 week, 5 days ago

Pastor goes off about Joe Biden and the rest of Hollywood, and how God is going to bring down the hammer on all the pedophiles and sex traffickers

2 weeks ago

All credit goes to Black Pilled!
---> https://www.youtube.com/watch?v=Ugi3rJAz2CQ
Black Pilled examines the 2002 film Gangs of New York and the truths it contains regarding today's war on Americans and how the oligarchy operates.

Other Black Pilled videos I mirrored:
How Boomers Were Taught to Hate (Themselves) - https://www.bitchute.com/video/MQ8JYwvJR1rQ/
The Great Boomer Deception - https://www.bitchute.com/video/e6CmuQUBMkAy/
The Nature of Power - [You Are Here]
Selling Divorce to the West - https://www.bitchute.com/video/WN1qUUVCDsNk/
Stand Still - https://www.bitchute.com/video/hXUUivbQaobA/
The Rise of Colossus - https://www.bitchute.com/video/CsZIPA3eszTM/
A Box of Chocolates - https://www.bitchute.com/video/GOPE0NT0IPNV/

My book "Day of the Rope" IS BACK, while you still can!
https://www.barnesandnoble.com/w/the-day-of-the-rope-devon-stack/1129595018?ean=9781078765398
AUDIOBOOK:
Google Play:
https://play.google.com/store/audiobooks/details/Devon_Stack_Day_of_the_Rope?id=AQAAAEBsbmouFM
Apple:
https://books.apple.com/us/audiobook/day-of-the-rope-book-1/id1496026143?mt=11
Audiobooks.com
https://www.audiobooks.com/audiobook/day-of-the-rope-book-1/419270#prompted

You may also support BlackPilled here (they demonetize most my videos):
SUBSCRIBESTAR:
https://www.subscribestar.com/blackpilled
PATREON:
https://www.patreon.com/blackpilled
OTHER:
https://blackpilled.com/donate/
Bitcoin (BTC): 3MfSmMkhkxmPsLW3DaqxefVzEBBDVsa4db
Bitcoin CASH (BCH):
1PAcbd732WbdJvtnANvJbQBvdouRNgsG2s
ETH:
0x9cb1F706b1bE726257187292148aD8DAAebD5A80
Litecoin:
MLiwiAaNsd8KFsMmPqcyimhWAjPEV5nxeR
Monero (XMR):
47c35fve7ipTpHsDDRMB83Dc7taW1KVYKjkqWKpEGY7JZQqUQQhpYrTe6eXc7r2nvE8Vd2kGuB1tx7mrEN753kf3EHLKr3M
ZCASH:
t1SkJNwoZ3oZrgJoYkqfrh2EnquXCzVGNDT

2 weeks ago

All credit goes to Truthstream Media!
--> https://www.youtube.com/watch?v=QxtwsPcfx1Q
So Disney Jr., the Disney brand aimed at preschoolers, apparently has a cartoon named Special Agent Oso (http://disneyjunior.com/special-agent-oso) that features a nanny state ladybug drone named Shutterbug which comes complete with a little camera that transmits video up to a satellite that then sends that data in to headquarters for analysis..."She's always in flight, on the case both day and night." (The "case," in this case, is an infraction involving a parent leaving her daughter in a parked car in their driveway without a seat belt on...)

Even die hard Disney fans that hate on us for reporting on them will have a hard time ignoring the obvious big brother propaganda and indoctrination going on in this creepy, creeeepy cartoon.

There's even a theme song...but we warn you; it's the stuff Orwell's nightmares were made of — https://www.youtube.com/watch?v=9hLowmoU5nU

Original article up at 21st Century Wire: https://21stcenturywire.com/2014/01/29/nsa-and-disney-animation-grooming-children-for-total-big-brother-and-big-nanny-society/

Recommended:
- https://nursingabc.com/upload/documents/Other_course_documents/SevenLessons.pdf ("The seventh lesson", pg. 5, 6)
- https://www.youtube.com/watch?v=Oew5DHa6RQ8 (audio of The Seven Lesson School Teacher)
- https://www.corbettreport.com/fisa-facebook-and-the-end-of-privacy/
- https://www.corbettreport.com/nothing-to-hide-nothing-to-fear/
- https://www.youtube.com/watch?v=lQI4lET97o4

"The seventh lesson I teach is that you can't hide.

I teach children they are always watched by keeping each student under constant surveillance as do my colleagues. There are no private spaces fo children, there is no private time. Class change lasts 300 seconds to keep promiscuous fraternization at low levels. Students are encouraged to tattle on each other, even to tattle on their parents.

Of course I encourage parents to file their own child's waywardness, too. A family trained to snitch on each other isn't likely to be able to conceal any dangerous secrets.

I assign a type of extended schooling called "homework", too, so that the surveillance travels into private households, where students might otherwise use free time to learn something unauthorized from a father or mother, or by apprenticing to some wise person in the neighborhood.

Disloyalty to the idea of schooling is a Devil always ready to find work for idle hands.

The meaning of constant surveillance and denial of privacy is that no one can be trusted, that privacy is not legitimate. Surveillance is an ancient urgency among certain influential thinkers, a central prescription set down Republic, in City of God, in Institutes of the Christian Religion, in New Atlantis, in Leviathan and many other places.

All these childless men who wrote these books discovered the same thing: children must be closely watched if you want to keep a society under tight central control. Children will follow a private drummer if you can't get them into a uniformed marching band."

=== Truthstream Media ===
Website: TruthstreamMedia.com
Twitter: @TruthstreamNews
FB: Facebook.com/TruthstreamMedia

~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~
Copyright Disclaimer Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use.

2 weeks ago
2 weeks, 1 day ago

Daily videos uploaded, please help support grow the channel by subscribing to get the truth out, I don’t do this for any financial gain and never will just simply want the truth out for people.

2 weeks, 1 day ago

THANKS FOR WATCHING! PLEASE LIKE & SUBSCRIBE!

This is not the full upgrade. They are fully upgrade >>>>> LUCIFER'S RACE <<<<< when the black programmable matter turns their eyes black. CERN is involved. Britney is currently there.

Think about it who did the Annunaki experiment on FIRST? THE REPTILIANS!
See video: https://www.bitchute.com/video/HiZSl4HmMHuj/

Tom Macdonald is a new being. WATCH HIS EYES IT"S REAL!! We're all brainwashed: https://www.bitchute.com/video/JyNEcLjumnks/

Mirrored: https://www.youtube.com/watch?v=Oq9xIVH4H8s

2 weeks, 2 days ago
2 weeks, 3 days ago

Resident Joe Biden has did the ultimate screw ups.. the Afghanistan crisis has set the world back 20 years.

1. Feature article reading from Mid South Tribune By Ms. Arelya J. Mitchell, Publisher/Editor-in-Chief " Joe Biden Must be Impeached and Charged with Treason"

https://themidsouthtribuneblog.wordpress.com/2021/08/19/joe-biden-must-be-impeached-and-charged-with-treason/

2. Hollywood burn news- Cinderella remake is just TRASH

3. Oregon has MASK MANDATE outdoors

4. Busta Rhymes is on fire , says "Fuck your Mask" that they government trampling over our civil liberties

5. Biden asked question by reporters they cut his mic

6. Tropical Storm Heri flooding apartments in New York

7. Shooter opened fire on Miami Beach tourist, danced over body: witness
https://nypost.com/2021/08/25/shooter-opened-fire-on-miami-beach-tourist-danced-over-body/

Visit my website at https://AxeTruth.com for all my links including the platforms that I stream live from. Join my mailing list to be notified about when I go live.

Thank you for your support!

2 weeks, 4 days ago

It's all true or it's all false. But we know that Hollywood elite travel to Epstein Island and one must Wonder how ready they are to tell the truth in order to have the unconditional love required for our collective ascension.

2 weeks, 4 days ago

All credit goes to The Corbett Report!
---> https://www.corbettreport.com/gaslight-film-literature-and-the-new-world-order/
In this edition of Film, Literature and the New World Order we welcome Thomas Sheridan, author of The Anvil of the Psyche, to discuss Gaslight, the 1940 British psychological thriller that introduced us to the concept of ‘gaslighting.’ In the discussion we point out how common gaslighting is, ask “Are you being gaslighted?”, talk about techniques for defending oneself from gaslighting, and talk about how this technique is used on a societal level by the psychopaths at the top of the pyramid.

Recommended:
- https://www.henrymakow.com/2021/01/youre-not-bigoted-or-crazy-you.html

2 weeks, 4 days ago

El sistema de películas y programas de Hollywod ha sido responsable en la era moderna de forjar la realidad de billones de personas a través de la ficción. El sistema iluminista de control en el entretenimiento quiere que aceptemos y normalicemos la violencia en las películas, el sexo sin amor y básicamente que los conflictos de los seres humanos estén dramatizados. Todo esto ha sido posible por que voluntariamente cedemos nuestra energia individual a ellos.
Un video importante. Hablamos deJim Henson, Stanley Kubrick, Roman Polanski, Quentin Tarantino, Martin Scorsese y otros.
Vídeo publicado en Youtube el 9 de diciembre de 2019.

3 weeks ago

An exposé on how Hollywood and the mainstream media manipulate the people by spreading propaganda, lies and deception throughout their content...

https://www.outofshadows.org/

3 weeks, 1 day ago

All credit goes to Upper Echelon Gamers!
---> https://www.youtube.com/watch?v=HKaC6elrank
"The Oscars, the Grammys, the Golden Globes, the Emmys... the entire cabal of Hollywood elitist awards ceremonies are falling apart, and the real reasons why are far more ingrained than what the media will ever acknowledge. The pandemic has exposed how disconnected Hollywood culture has become, and I for one am not very sad about it."

Recommended:
- https://www.henrymakow.com/2021/06/stone-why-most-movies-are-crap.html
- https://rielpolitik.com/2020/04/17/crossroads-no-we-are-not-all-in-this-together-by-brandon-smith/

Thank you to Keeps for sponsoring this video. Go to https://www.keeps.com/ueg to get 50% off your first order of Keeps hair loss treatment.

ODYSEE INVITE: https://odysee.com/$/invite/@UpperEch...

LOCALS: https://upperechelon.locals.com/post/...

https://upperechelon.locals.com/support

⦁ Axial GT's Channel: https://www.youtube.com/c/AxialGaming... Thank You. Subscribe to him please!

⦁ UPPER ECHELON WEBSITE: https://upperechelon.gg

⦁NEW⦁ UPPER ECHELON CUSTOM MERCH STORE: http://btlspk.co/avvklf/direct

⦁ DONATIONS ACCEPTED: https://streamlabs.com/upperechelongamers/tip

⦁ TWITCH LINK: https://www.twitch.tv/upperechelongamers

⦁ FACEBOOK: https://www.facebook.com/groups/265696447142986/

⦁ DISCORD SERVER: https://discord.gg/9eAwta8

⦁ TWITTER: https://twitter.com/UE_UpperEchelon

⦁ Video Transitions: William Eklof

⦁ Outtro Song: https://www.youtube.com/watch?v=-k4az...

GAMERTAG: UE Sanctionite

3 weeks, 1 day ago
3 weeks, 2 days ago

All credit goes to Black Pilled!
---> https://www.youtube.com/watch?v=oH53ViUaqqw
Black Pilled examines the 1994 film Forest Gump and how it's a subtle yet effective piece of Hollywood propaganda promoting the abdication of personal responsibility and morality.

Recommended:
- https://www.henrymakow.com/001364.html
- https://www.youtube.com/watch?v=2QoA2-ckGEI

Other Black Pilled videos I mirrored:
How Boomers Were Taught to Hate (Themselves) - https://www.bitchute.com/video/MQ8JYwvJR1rQ/
The Great Boomer Deception - https://www.bitchute.com/video/e6CmuQUBMkAy/
Selling Divorce to the West - https://www.bitchute.com/video/WN1qUUVCDsNk/
The Nature of Power - https://www.bitchute.com/video/wFbXNqCfD3pp/
Stand Still - https://www.bitchute.com/video/hXUUivbQaobA/
The Rise of Colossus - https://www.bitchute.com/video/CsZIPA3eszTM/
A Box of Chocolates - [You Are Here]

My book "Day of the Rope" IS BACK, while you still can!
https://www.barnesandnoble.com/w/the-day-of-the-rope-devon-stack/1129595018?ean=9781078765398
AUDIOBOOK:
Google Play:
https://play.google.com/store/audiobooks/details/Devon_Stack_Day_of_the_Rope?id=AQAAAEBsbmouFM
Apple:
https://books.apple.com/us/audiobook/day-of-the-rope-book-1/id1496026143?mt=11
Audiobooks.com
https://www.audiobooks.com/audiobook/day-of-the-rope-book-1/419270#prompted

You may also support BlackPilled here (they demonetize most my videos):
SUBSCRIBESTAR:
https://www.subscribestar.com/blackpilled
PATREON:
https://www.patreon.com/blackpilled
OTHER:
https://blackpilled.com/donate/
Bitcoin (BTC): 3MfSmMkhkxmPsLW3DaqxefVzEBBDVsa4db
Bitcoin CASH (BCH):
1PAcbd732WbdJvtnANvJbQBvdouRNgsG2s
ETH:
0x9cb1F706b1bE726257187292148aD8DAAebD5A80
Litecoin:
MLiwiAaNsd8KFsMmPqcyimhWAjPEV5nxeR
Monero (XMR):
47c35fve7ipTpHsDDRMB83Dc7taW1KVYKjkqWKpEGY7JZQqUQQhpYrTe6eXc7r2nvE8Vd2kGuB1tx7mrEN753kf3EHLKr3M
ZCASH:
t1SkJNwoZ3oZrgJoYkqfrh2EnquXCzVGNDT

3 weeks, 2 days ago
3 weeks, 4 days ago

Arnold Nolastnamenecessary.

3 weeks, 5 days ago

Tranny’s tranny’s everywhere! Lol

3 weeks, 5 days ago

Supercar at the intersection of superdrunk
In Hollywood, an early morning crash resulted in an orange Lamborghini being partially tangled in the fence of a U.S. Postal Office vehicle yard. The drive was arrested on suspicion of DUI

3 weeks, 6 days ago

"An Open Secret is an American documentary film directed by Amy J. Berg exposing child sexual abuse in Hollywood."

Directed by Amy Berg (2014).

4 weeks ago

Revealing bikinis, enticing poses, glamour, adventure, funny innuendos, child abuse, a little bit for everybody!
Some Logan's Run, as well. Why not? Gotta keep it Green.
Original list: https://www.007james.com/articles/list_of_james_bond_girls.php

Victor López - James Bond Medley

4 weeks ago

Lila Quarter-man, get it?
What do Anna Lee, Anna Lee and Anna Lee have in common?
One wonders.

Interview: https://www.youtube.com/watch?v=_QGGzUMNSwI

Dream Theater - Anna Lee

4 weeks ago

All credit goes to Truthstream Media!
---> https://www.youtube.com/watch?v=VaN7NJ18kUw
While every other Hollywood film and cartoon is using predictive programming and revelation of the method to enlighten the public on just how easily minds can be controlled, your loving Defense Advanced Research Projects Agency is quickly working to make those technologies a reality.

Source: https://www.fbo.gov/index?s=opportuni...

Please help support us on Patreon, read our goals here: https://www.patreon.com/truthstreammedia

Truthstream Can Be Found Here:
Our Film: TheMindsofMen.net
Site: http://TruthstreamMedia.com
Twitter: @TruthstreamNews
DONATE: http://bit.ly/2aTBeeF
Newsletter: http://eepurl.com/bbxcWX
~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*­~*~*~*~*~

Copyright Disclaimer Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use.

4 weeks ago

All credit goes to Truthstream Media!
---> https://www.youtube.com/watch?v=TYulpc4r4xo
Revelation of the method and predictive programming always show up together in a nifty little package, don't they?

Truthstream Can Be Found Here:
Website: http://TruthstreamMedia.com
FB: http://Facebook.com/TruthstreamMedia
Twitter: @TruthstreamNews
Newsletter: http://eepurl.com/bbxcWX

~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*­~*~*~*~*~

Copyright Disclaimer Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use.

4 weeks, 1 day ago

All credit goes to Black Pilled!
---> https://www.youtube.com/watch?v=2ZXGyfzh4TA
Black Pilled covers the 1951 film The Day The Earth Stood Still (and it's 2008 remake) and its underlying globalist message.

Recommended:
- https://www.bitchute.com/video/ZoypPQl2sfJH/ (montage documentary of several videos)

"Another plan is in force. It is the plan to prepare the public for eventual confrontation with an alien race. It could also intend to make you believe in an alien race that may not exist. The public is being bombarded with movies, radio, advertising, and TV programs depicting almost every aspect of the purported true nature of an alien presence. This includes the good and the bad. Look around and pay attention. Someone is planning to make their presence known and the government is preparing you for it. They do not want any panic. The unprecedented number of sightings worldwide indicates that public exposure is not far off. Never in history have there been so many incidents involving UFOs and never in history have there been so many official acknowledgments"
- Behold a Pale Horse (1991) by Bill Cooper

"Some one remarked that the best way to unite all the nations on this globe would be an attack from some other planet. In the face of such an alien enemy, people would respond with a sense of their unity of interest and purpose. We have the next thing to that at the present time”
- John Dewey (1917)

“I occasionally think how quickly our differences worldwide would vanish if we were facing an alien threat from outside this world.”
- Ronald Reagan (1987)

"Today, America would be outraged if UN troops entered Los Angeles to restore order. Tomorrow they will be grateful! This is especially true if they were told that there was an outside threat from beyond, whether real or promulgated, that threatened our very existence. It is then that all people of the world will plead to deliver them from this evil. The one thing every man fears is the unknown. When presented with this scenario, individual rights will be willingly relinquished for the guarantee of their well-being granted to them by the world government.“
- Henry Kissinger (1991)

"If we discovered that, you know, space aliens were planning to attack and we needed a massive buildup to counter the space alien threat and really inflation and budget deficits took secondary place to that, this slump would be over in 18 months. … There was a Twilight Zone episode like this in which scientists fake an alien threat in order to achieve world peace. Well, this time, we don't need it, we need it in order to get some fiscal stimulus."
- Paul Krugman (2011)

"If we were visited someday, I wouldn’t be surprised. I just hope that it’s not like Independence Day. You know, a conflict. Maybe that’s the only way to unite this increasingly divided world of ours. If they’re out there we’d better think of how all the differences among people on earth would seem small if we felt threatened by a space invader that the whole theory of Independence Day – everybody gets together and makes nice."
- Bill Clinton (2014)

Other Black Pilled videos I mirrored:
How Boomers Were Taught to Hate (Themselves) - https://www.bitchute.com/video/MQ8JYwvJR1rQ/
The Great Boomer Deception - https://www.bitchute.com/video/e6CmuQUBMkAy/
Selling Divorce to the West - https://www.bitchute.com/video/WN1qUUVCDsNk/
The Nature of Power - https://www.bitchute.com/video/wFbXNqCfD3pp/
Stand Still - [You Are Here]
The Rise of Colossus - https://www.bitchute.com/video/CsZIPA3eszTM/
A Box of Chocolates - https://www.bitchute.com/video/GOPE0NT0IPNV/

My book "Day of the Rope" IS BACK, while you still can!
https://www.barnesandnoble.com/w/the-day-of-the-rope-devon-stack/1129595018?ean=9781078765398
AUDIOBOOK:
Google Play:
https://play.google.com/store/audiobooks/details/Devon_Stack_Day_of_the_Rope?id=AQAAAEBsbmouFM
Apple:
https://books.apple.com/us/audiobook/day-of-the-rope-book-1/id1496026143?mt=11
Audiobooks.com
https://www.audiobooks.com/audiobook/day-of-the-rope-book-1/419270#prompted

You may also support BlackPilled here (they demonetize most my videos):
SUBSCRIBESTAR:
https://www.subscribestar.com/blackpilled
PATREON:
https://www.patreon.com/blackpilled
OTHER:
https://blackpilled.com/donate/
Bitcoin (BTC): 3MfSmMkhkxmPsLW3DaqxefVzEBBDVsa4db
Bitcoin CASH (BCH):
1PAcbd732WbdJvtnANvJbQBvdouRNgsG2s
ETH:
0x9cb1F706b1bE726257187292148aD8DAAebD5A80
Litecoin:
MLiwiAaNsd8KFsMmPqcyimhWAjPEV5nxeR
Monero (XMR):
47c35fve7ipTpHsDDRMB83Dc7taW1KVYKjkqWKpEGY7JZQqUQQhpYrTe6eXc7r2nvE8Vd2kGuB1tx7mrEN753kf3EHLKr3M
ZCASH:
t1SkJNwoZ3oZrgJoYkqfrh2EnquXCzVGNDT

1 month ago

Our model was built with a 60% option. You must STOP IT. Shhh 22 Aug. We can control outcome dream state while awake. The dearly departed forgot they don't depart. Lol..be Christ in mind and body. 22 Aug is the initial baptism of spirit. Hopefully you are pleased with YOURSELF and have the known bliss of that guy on that day. You must be tuned in properly. Your divine inheritance must be claimed and sought. Not just read about, or listened to as another thing on your list of incomplete..YOU.

1 month ago

buck rogers
star trek
doc who
star wars
all with hot strong white guys and long hair hot women
no more annoyances or anti white male shit
scifi show about post scarcity society :) lots of hot sex

1 month ago

DISCOURAGING FAMILY WITH THEIR FILM

JUDASFINKELSTEIN

We need our own Hollywood.

https://www.youtube.com/channel/UCJQyCdxwdZI4-xVDDx7ulUQ

1 month ago

Reptilians are just people who signed pacts and did ghastly rituals; blasphemed the Holy Spirit and damned THEMSELVES. This video shows what I mean. https://www.bitchute.com/video/RiWkOd3C3dzo/
THANKS FOR WATCHING! PLEASE LIKE AND SUBSCRIBE!
Mirrored: https://www.youtube.com/watch?v=-BGK6loCMa8

1 month ago

Some you may know. Some I bet you do not.
JONESTOWN USA: THE VACCINE IS MASS SUICIDE AND THE TELEVISION IS JIM JONES
https://www.bitchute.com/video/2wGk9JUerLne/
Their screams are being silenced by the media. It is murder. It is GENOCIDE.
https://www.bitchute.com/video/qEMI2AAiiHGO/

1 month ago

Some you may know. Some I bet you do not.
JONESTOWN USA: THE VACCINE IS MASS SUICIDE AND THE TELEVISION IS JIM JONES
https://www.bitchute.com/video/2wGk9JUerLne/
Their screams are being silenced by the media. It is murder. It is GENOCIDE.
https://www.bitchute.com/video/qEMI2AAiiHGO/

1 month ago
1 month ago

Hollywood wimp puppets keep spewing their verbal diarrhea on command.

1 month ago
WAK

❶ ❼ ❽ ❹ ❶ ❷ ❶
Grandioser Zusammenschnitt! (1940 - 2020)
B̲i̲t̲t̲e̲: Abonnieren • Bewerten • Kommentieren • V​erbreiten
Filme:
1940 - Der große Diktator
1943 - Chicken Little
1976 - Network
1979 - Die Hamburger Krankheit
1982 - Blut und Ehre
1987 - Es war einmal das Leben
1988 - Sie leben
1989 - Erik der Wikinger
1991 - Die Simpsons
1991 - Ein Engel auf Erden
1995 - Johnny Mnemonic
1996 - Der grüne Planet
1999 - The Devil Lady
1999 - The Matrix
2003 - Die Simpsons
2005 - V wie Vendetta
2007 - Vexille
2009 - CSI: Vegas
2010 - Die Simpsons
2011 - The Veteran
2012 - Gray State
2013 - Utopia
2016 - Akte X
2016 - Person of Interest
2018 - Counterpart
2019 - In the Shadow of the Moon
2019 - Hindafing
2019 - Stretch Armstrong und die Flex Fighters
2020 - Songbird
• Kinder ШΞG • Freiheit ШΞG • Gesundheit ШΞG • Haus ШΞG • Auto ШΞG • Geld ШΞG • Eigentum ШΞG •
Wollt Ihr Euch tatsächlich komatös benehmen und nicht dagegen aufstehen?
1.ШΞG mit Eurer Denkbetreuung (TV, Zeitung usw.) und mit Familie, Nachbarn und Freunden auf die Straße!
2.Häufiges Birkenbihl-Lächeln
3.Liebe, schätze Dich selbst, sonst liebt, schätzt Dich niemand!
D̲̲i̲̲e̲̲s̲̲e̲̲n̲̲ Aufklärungs-Link gegen Fake-News je̲̲t̲̲z̲̲t̲̲ weitergeben: [https://bridgeurl.com/aufwachen]
Zuerst ignorieren sie Dich, dann lachen sie über Dich, dann bekämpfen sie Dich, und dann gewinnst Du!
Sicherungskopie in Kürze auf: https://www.brighteon.com/channels/awaker

1 month ago
1 month ago

Private detective Philip Marlowe is hired by a wealthy family. Before the complex case is over, he's seen murder, blackmail, and what might be love.

Stars: Humphrey Bogart, Lauren Bacall, John Ridgely
Director: Howard Hawks

1 month ago

Years after her aunt was murdered in her home, a young woman moves back into the house with her new husband. However, he has a secret that he will do anything to protect, even if it means driving his wife insane.

Stars: Charles Boyer, Ingrid Bergman, Joseph Cotten
Director: George Cukor

1 month, 1 week ago